PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000387G0730
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRF
Protein Properties Length: 454aa    MW: 49141.9 Da    PI: 7.2424
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000387G0730genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.11.7e-2472116145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  PH01000387G0730  72 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKHVEG 116
                      79****************************************986 PP

2QLQ56.58.5e-20742237
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                     +FT++Q+ +L++Q+l+yKyLaan PvP+ Ll++i++
  PH01000387G0730  7 PFTPSQWIELEHQALIYKYLAANSPVPHGLLLPIRR 42
                     9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.8E-10642IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.3E-14741IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.897742IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.45572116IPR014977WRC domain
PfamPF088791.5E-2073115IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MARVRAPFTP SQWIELEHQA LIYKYLAANS PVPHGLLLPI RRSLASPYSP AYFGTSTLGW  60
GSFQLGYSGS ADPEPGRCRR TDGKKWRCSR DAVADQKYCE RHMNRGRHRS RKHVEGQPGH  120
AAKAMPAVVA ASAAASATQP SALAAAGGGA TAGLTINHQQ QPVKSYAANT TDPCWLQYNR  180
ELVNKQNESE QMQDSDSLSM LTSVNTRNTG SLFPFSKQHN PFDLMSSRPD FGLVSSDSLM  240
SSPHSSLENV NLLSSQSLNE HQSSVFLQHF VDWPRTPAQG ALGWPDAEEM QAQRTQLSIS  300
APMASSDLSS ASTSPIHEKL MLSPLKLSRE YSPIGLSMAA NKDEVSQGEA NWTPMFHDSS  360
MDGPLGEVLT KNSNMETRNC LLASLNLLTD GWDSSPGMQS SPVGVLQKTT FGSVSSSTGS  420
SPRLENHSVY DGISNLRDDL GSIVVNHPSI RLV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628630.10.0PREDICTED: growth-regulating factor 6
SwissprotQ6AWY30.0GRF6_ORYSJ; Growth-regulating factor 6
TrEMBLA0A0P0W3660.0A0A0P0W366_ORYSJ; Os03g0729500 protein
STRINGLOC_Os03g51970.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42903568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.14e-47growth-regulating factor 2